SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414415 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414415
Domain Number 1 Region: 880-1104
Classification Level Classification E-value
Superfamily RNI-like 2.85e-57
Family 28-residue LRR 0.0032
Further Details:      
 
Domain Number 2 Region: 675-918
Classification Level Classification E-value
Superfamily RNI-like 1.18e-56
Family 28-residue LRR 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSP00000414415
Domain Number - Region: 191-271,306-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00023
Family Nitrogenase iron protein-like 0.091
Further Details:      
 
Domain Number - Region: 585-622
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0916
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414415   Gene: ENSG00000167984   Transcript: ENST00000448023
Sequence length 1111
Comment pep:known chromosome:GRCh37:16:3589038:3627401:-1 gene:ENSG00000167984 transcript:ENST00000448023 gene_biotype:polymorphic_pseudogene transcript_biotype:protein_coding
Sequence
MEMDAPRPPSLAVPGAASRPGRLLDGGHGRQQVQALSSQLLEVIPDSMRKQEVRTGREAG
QGHGTGSPAEQVKALMDLLAGKGSQGSQAPQALDRTPDAPLGPCSNDSRIQRHRKALLSK
VGGGPELGGPWHRLASLLLVEGLTDLQLREHDFTQVEATRGGGHPARTVALDRLFLPLSR
VSVPPRVSITIGVAGMGKTTLVRHFVRLWAHGQVGKDFSLVLPLTFRDLNTHEKLCADRL
ICSVFPHVGEPSLAVAVPARALLILDGLDECRTPLDFSNTVACTDPKKEIPVDHLITNII
RGNLFPEVSIWITSRPSASGQIPGGLVDRMTEIRGFNEEEIKVCLEQMFPEDQALLGWML
SQVQADRALYLMCTVPAFCRLTGMALGHLWRSRTGPQDAELWPPRTLCELYSWYFRMALS
GEGQEKGKASPRIEQVAHGGRKMVGTLGRLAFHGLLKKKYVFYEQDMKAFGVDLALLQGA
PCSCFLQREETLASSVAYCFTHLSLQEFVAAAYYYGASRRAIFDLFTESGVSWPRLGFLT
HFRSAAQRAMQAEDGRLDVFLRFLSGLLSPRVNALLAGSLLAQGEHQAYRTQVAELLQGC
LRPDAAVCARAINVLHCLHELQHTELARSVEEAMESGALARLTGPAHRAALAYLLQVSDA
CAQEANLSLSLSQGVLQSLLPQLLYCRKLRLDTNQFQDPVMELLGSVLSGKDCRIQKISL
AENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNT
VRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADLKQNRSLKELMFSSNSIGDGG
AKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAI
AHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQAL
QLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNR
TLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQH
INLQGNHIGDSGARMISEAIKTNAPTCTVEM
Download sequence
Identical sequences 9606.ENSP00000414415 ENSP00000414415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]