SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414635 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414635
Domain Number 1 Region: 106-425
Classification Level Classification E-value
Superfamily RNI-like 6.11e-62
Family 28-residue LRR 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414635   Gene: ENSG00000171757   Transcript: ENST00000446859
Sequence length 464
Comment pep:known chromosome:GRCh37:3:169511216:169530452:-1 gene:ENSG00000171757 transcript:ENST00000446859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQPPRPVGERSMGSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNL
CMEKSQKINPFILHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILK
NCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRT
LKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTQNQAIKAI
NLNRPILYSEQEESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLD
VSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKALSVVS
NNIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEATCIAYSDLIQMGCLKPDNTDVEPFVV
DGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP
Download sequence
Identical sequences Q8IZ02
ENSP00000326150 ENSP00000414635 gi|289666780|ref|NP_001166250.1| NP_001166250.1.87134 NP_001166250.1.92137 ENSP00000414635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]