SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414670 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414670
Domain Number 1 Region: 240-402
Classification Level Classification E-value
Superfamily RNI-like 1.44e-41
Family 28-residue LRR 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414670   Gene: ENSG00000163380   Transcript: ENST00000420581
Sequence length 560
Comment pep:known chromosome:GRCh37:3:69156023:69171717:-1 gene:ENSG00000163380 transcript:ENST00000420581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEHSRNSDQEELLDEEINEDEILANLSAEELKELQSEMEVMAPDPSLPVGMIQKDQTDK
PPTGNFNHKSLVDYMYWEKASRRMLEEERVPVTFVKSEEKTQEEHEEIEKRNKNMAQYLK
EKLNNEIVANKRESKGSSNIQETDEEDEEEEDDDDDDEGEDDGEESEETNREEEGKAKEQ
IRNCENNCQQVTDKAFKEQRDRPEAQEQSEKKISKLDPKKLALDTSFLKVSTRPSGNQTD
LDGSLRRVRKNDPDMKELNLNNIENIPKEMLLDFVNAMKKNKHIKTFSLANVGADENVAF
ALANMLRENRSITTLNIESNFITGKGIVAIMRCLQFNETLTELRFHNQRHMLGHHAEMEI
ARLLKANNTLLKMGYHFELPGPRMVVTNLLTRNQDKQRQKRQEEQKQQQLKEQKKLIAML
ENGLGLPPGMWELLGGPKPDSRMQEFFQPPPPRPPNPQNVPFSQRSEMMKKPSQAPKYRT
DPDSFRVVKLKRIQRKSRMPEAREPPEKTNLKDVIKTLKPVPRNRPPPLVEITPRDQLLN
DIRHSSVAYLKPVQLPKELA
Download sequence
Identical sequences Q0VAK6
gi|54607116|ref|NP_938012.2| 9606.ENSP00000414670 ENSP00000414670 ENSP00000417210 ENSP00000418645 NP_001291347.1.87134 NP_001291347.1.92137 NP_938012.2.87134 NP_938012.2.92137 ENSP00000414670 ENSP00000414670 ENSP00000417210 ENSP00000418645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]