SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415173 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415173
Domain Number 1 Region: 270-326
Classification Level Classification E-value
Superfamily SH3-domain 1.12e-18
Family SH3-domain 0.00069
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.000000286
Family Cofilin-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415173   Gene: ENSG00000136279   Transcript: ENST00000440166
Sequence length 327
Comment pep:putative chromosome:GRCh37:7:44084275:44100744:1 gene:ENSG00000136279 transcript:ENST00000440166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ
KTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQR
YQEQGGEASPQRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGKLRS
PFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETF
YEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEV
IDEGWWRGYGPDGHFGMFPANYVELIE
Download sequence
Identical sequences NP_001271242.1.87134 NP_001271242.1.92137 ENSP00000415173 ENSP00000415173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]