SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415314 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415314
Domain Number 1 Region: 37-163
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.62e-27
Family GABA-aminotransferase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415314   Gene: ENSG00000139631   Transcript: ENST00000437073
Sequence length 163
Comment pep:putative chromosome:GRCh37:12:53565188:53574430:-1 gene:ENSG00000139631 transcript:ENST00000437073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLEL
RSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLA
Download sequence
Identical sequences E9PFW9
ENSP00000415314 ENSP00000415314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]