SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415577 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415577
Domain Number 1 Region: 144-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000058
Family EGF-type module 0.008
Further Details:      
 
Domain Number 2 Region: 109-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSP00000415577
Domain Number - Region: 197-227
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0196
Family Mitotic arrest deficient-like 1, Mad1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415577   Gene: ENSG00000240389   Transcript: ENST00000414111
Sequence length 293
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_APD:32143703:32147402:1 gene:ENSG00000240389 transcript:ENST00000414111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRAELCTLLGGFSFLLLLIPGEGAKGGSLRESQGVCSKQTLVVPLHYNESYSQPVYKP
YLTLCAGRRICSTYRTMYRVMWREVRREVQQTHAVCCQGWKKRHPGALTCEAICAKPCLN
GGVCVRPDQCECAPGWGGKHCHVDVDECRTSITLCSHHCFNTAGSFTCGCPHDLVLGVDG
RTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRGRLERLEQWAGQAGAWVRAVL
PVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACSCEDNSLGLGVNHR
Download sequence
Identical sequences A0A1U9X7N9 Q99944
ENSP00000333380 ENSP00000387353 ENSP00000388000 ENSP00000390866 ENSP00000394193 ENSP00000403075 9606.ENSP00000333380 9606.ENSP00000388000 9606.ENSP00000397426 9606.ENSP00000405502 9606.ENSP00000411023 9606.ENSP00000414996 ENSP00000333380 ENSP00000378888 ENSP00000388000 ENSP00000390866 ENSP00000394193 ENSP00000397426 ENSP00000398893 ENSP00000405502 ENSP00000411023 ENSP00000414996 ENSP00000415577 ENSP00000416366 NP_085155.1.87134 NP_085155.1.92137 gi|13449287|ref|NP_085155.1| ENSP00000333380 ENSP00000378888 ENSP00000388000 ENSP00000390866 ENSP00000394193 ENSP00000397426 ENSP00000398893 ENSP00000405502 ENSP00000411023 ENSP00000414996 ENSP00000415577 ENSP00000416366 ENSP00000446578 ENSP00000447923 ENSP00000448327 ENSP00000450189 ENSP00000476083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]