SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416227 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000416227
Domain Number - Region: 14-118
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416227   Gene: ENSG00000156603   Transcript: ENST00000431606
Sequence length 244
Comment pep:known chromosome:GRCh37:11:57471186:57479681:-1 gene:ENSG00000156603 transcript:ENST00000431606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGA
GCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
SHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHK
QSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSS
SSLR
Download sequence
Identical sequences ENSP00000337340 ENSGGOP00000017193 ENSP00000416227 ENSP00000416227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]