SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416442 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416442
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 9.81e-24
Family MOSC N-terminal domain-like 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSP00000416442
Domain Number - Region: 107-171
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000607
Family MOSC (MOCO sulphurase C-terminal) domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416442   Gene: ENSG00000117791   Transcript: ENST00000425560
Sequence length 172
Comment pep:known chromosome:GRCh37:1:220928314:220953491:1 gene:ENSG00000117791 transcript:ENST00000425560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRD
CGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDAS
LVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPR
Download sequence
Identical sequences X1WI34
ENSP00000416442 ENSP00000416442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]