SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416658 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416658
Domain Number 1 Region: 18-166
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.31e-47
Family Nucleoside diphosphate kinase, NDK 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416658   Gene: ENSG00000172113   Transcript: ENST00000421967
Sequence length 194
Comment pep:known chromosome:GRCh37:3:48334754:48342848:-1 gene:ENSG00000172113 transcript:ENST00000421967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWR
KEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAP
DSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEG
GVHYVAGTGGLGPA
Download sequence
Identical sequences A0A0C4DG91 H2PAV2 K7BNT0
ENSP00000416658 ENSPPYP00000015557 9600.ENSPPYP00000015557 9606.ENSP00000416658 gi|5031951|ref|NP_005784.1| ENSP00000391499 NP_005784.1.87134 NP_005784.1.92137 XP_002813843.1.23681 XP_003818471.1.60992 XP_016796507.1.37143 XP_018879656.1.27298 ENSPPYP00000015557 HR6682 ENSP00000416658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]