SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416921 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416921
Domain Number 1 Region: 56-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000183
Family HLH, helix-loop-helix DNA-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416921   Gene: ENSG00000213347   Transcript: ENST00000427908
Sequence length 193
Comment pep:known chromosome:GRCh37:5:176732501:176738899:-1 gene:ENSG00000213347 transcript:ENST00000427908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRS
VHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLK
ERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQVLPNENGGTPNH
RPTGRGNNISSHH
Download sequence
Identical sequences ENSP00000416921 gi|219283190|ref|NP_001136407.1| ENSP00000416921 NP_001136407.1.87134 NP_001136407.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]