SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416986 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416986
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416986   Gene: ENSG00000122691   Transcript: ENST00000443687
Sequence length 70
Comment pep:known chromosome:GRCh37:7:19060614:19156547:-1 gene:ENSG00000122691 transcript:ENST00000443687 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRM
EGAWSMSASH
Download sequence
Identical sequences H7C4D7
ENSP00000416986 ENSP00000416986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]