SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417146 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417146
Domain Number 1 Region: 266-439,479-564,593-621,689-796
Classification Level Classification E-value
Superfamily Cysteine proteinases 1e-83
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00065
Further Details:      
 
Domain Number 2 Region: 123-230
Classification Level Classification E-value
Superfamily RING/U-box 6.24e-33
Family Zf-UBP 0.00000447
Further Details:      
 
Domain Number 3 Region: 658-704
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000606
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417146   Gene: ENSG00000058056   Transcript: ENST00000496897
Sequence length 798
Comment pep:putative chromosome:GRCh37:3:179371481:179502194:1 gene:ENSG00000058056 transcript:ENST00000496897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDD
LNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENE
LPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHA
LEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHGTENGL
QDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEFQRAYV
GNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQQNGIS
PRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQ
TRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIPFSACL
QAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFDVSIDM
PDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQLAEMG
FPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLD
NQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEMENNAN
ANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDHKVCAS
ERPPKDLGYMYFYRRIPS
Download sequence
Identical sequences ENSP00000417146 ENSP00000417146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]