SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417352 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417352
Domain Number 1 Region: 4-194
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.09e-40
Family GABA-aminotransferase-like 0.00000993
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417352   Gene: ENSG00000023330   Transcript: ENST00000493402
Sequence length 237
Comment pep:novel chromosome:GRCh37:3:52240648:52248241:1 gene:ENSG00000023330 transcript:ENST00000493402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRVPKYIFRHNDVSHLRELLQRSDPSVPKIVAFETVHSMDGKAFGCVGGYIASTSSLIDT
VRSYAAGFIFTTSLPPMLLAGALESVRILKSAEGRVLRRQHQRNVKLMRQMLMDAGLPVV
HCPSHIIPVRVADAAKNTEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMM
NYFLENLLVTWKQVGLELKPHSSAECNFCRRPLHFEVMSEREKSYFSGLSKLVSAQA
Download sequence
Identical sequences H7C4H7
ENSP00000417352 ENSP00000417352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]