SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417432 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417432
Domain Number 1 Region: 223-292
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.22e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417432   Gene: ENSG00000105967   Transcript: ENST00000484212
Sequence length 316
Comment pep:novel chromosome:GRCh37:7:115581810:115799950:-1 gene:ENSG00000105967 transcript:ENST00000484212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQALTGLQFQLKEQLGEKERRLQISQEISAHRTEFHMQFSYKPVLHRLVPARPQIYSSQ
LPSFTRVPAHLESSARPQLQKAQRQKVNSFMTLDHQIINPTLKWSQPAVPSGGPLVQHAH
TTLDSDAGLTENPLTKLLAIGKEDDNAQWHMEDVIEDIIGMESSFKEEGADSPLLMQRTL
SGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERR
RRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLE
QANRRLLLRIQVFIRM
Download sequence
Identical sequences B7Z757
ENSP00000417432 ENSP00000417432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]