SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417601 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417601
Domain Number 1 Region: 20-395
Classification Level Classification E-value
Superfamily RNI-like 1.57e-54
Family Cyclin A/CDK2-associated p19, Skp2 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417601   Gene: ENSG00000153558   Transcript: ENST00000484457
Sequence length 423
Comment pep:known chromosome:GRCh37:3:33318914:33429584:1 gene:ENSG00000153558 transcript:ENST00000484457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNF
QTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDS
TCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRG
CRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALC
LSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILIT
DSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALE
HLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC
VIL
Download sequence
Identical sequences A0A2K5E5B2 A0A2K6R3N6 G1QXF3 G3QJA1 H2PB83 H2QM94 Q9UKC9
9598.ENSPTRP00000025409 9600.ENSPPYP00000015699 9606.ENSP00000417601 ENSNLEP00000005624 ENSGGOP00000002488 ENSP00000417601 ENSP00000389251 gi|284447308|ref|NP_036289.3| ENSPPYP00000015699 ENSNLEP00000005624 ENSPTRP00000025409 ENSP00000417601 NP_036289.3.87134 NP_036289.3.92137 XP_003256880.1.23891 XP_003826174.1.60992 XP_004033863.1.27298 XP_010371268.1.97406 XP_012290969.1.9421 XP_516355.3.37143 ENSPPYP00000015699 ENSPTRP00000025409 ENSGGOP00000002488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]