SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417910 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417910
Domain Number 1 Region: 159-270
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.8e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.0004
Further Details:      
 
Domain Number 2 Region: 282-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000187
Family Ankyrin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 98-143
Classification Level Classification E-value
Superfamily PH domain-like 0.000000795
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417910   Gene: ENSG00000133612   Transcript: ENST00000461065
Sequence length 404
Comment pep:putative chromosome:GRCh37:7:150831512:150841523:1 gene:ENSG00000133612 transcript:ENST00000461065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEIDLLRTTVKVPGKRLPRATPATAPGTSPRANGLSVERSNTQLGGGTASGPAEVLSSSP
KLDPPPSPHSNRKKHRRKKSTGTPRPDGPSSATEEAEESFEFVVVSLTGQTWHFEASTAE
ERELWVQSVQAQILASLQGCRSAKDKTRLGNQNAALAVQAVRTVRGNSFCIDCDAPNPDW
ASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALG
GYSKPGPDACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAH
GSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGS
QECADILIQHGCPGEGCGLAPTPNREPANGTNPSAELHRSPSLL
Download sequence
Identical sequences H0Y873
ENSP00000417910 ENSP00000417910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]