SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 75_37 > ENSP00000417914

Domain assignment for ENSP00000417914 from Homo sapiens 75_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000417914
Domain Number 1	Region: 39-281
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	1.56e-51
Family	Ankyrin repeat	0.00017
Further Details:

Domain Number 2	Region: 280-322
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.0000017
Family	SOCS box-like	0.0045
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000417914 Gene: ENSG00000165192 Transcript: ENST00000480796
Sequence length	323
Comment	pep:known chromosome:GRCh37:X:15301166:15333778:-1 gene:ENSG00000165192 transcript:ENST00000480796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGIS DCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLEN GAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECME ILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSN VEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLG RACHQAIHKLHLPEPLERFLLYQ
Download sequence
Identical sequences	Q8WXH4 NP_543149.1.87134 NP_543149.1.92137 ENSP00000417914 9606.ENSP00000417914 ENSP00000417914 gi\|18254474\|ref\|NP_543149.1\| ENSP00000417914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]