SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418111 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418111
Domain Number 1 Region: 6-257
Classification Level Classification E-value
Superfamily RNI-like 6.87e-41
Family Cyclin A/CDK2-associated p19, Skp2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418111   Gene: ENSG00000145743   Transcript: ENST00000496714
Sequence length 314
Comment pep:known chromosome:GRCh37:5:107213938:107703655:-1 gene:ENSG00000145743 transcript:ENST00000496714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQ
LGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPEL
QYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWI
INDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLI
AQSSKSLRYLGLMRCDKVRVDYQVVCFLHISIVNSLMSYPLSFSISTPVYYILYIHFICI
YAIIAMHCLPAFVN
Download sequence
Identical sequences 9606.ENSP00000418111 ENSP00000418111 ENSP00000418111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]