SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418529 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418529
Domain Number 1 Region: 255-370
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.05e-33
Family UBX domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 176-271
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.26e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000323
Family TAP-C domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418529   Gene: ENSG00000088833   Transcript: ENST00000476071
Sequence length 372
Comment pep:known chromosome:GRCh37:20:1422807:1447563:-1 gene:ENSG00000088833 transcript:ENST00000476071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRSRFYAGGSERSGQQIVGPPRKKSPNEL
VDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQ
DVHVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDH
RDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNI
QIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEA
NLLNAVIVQRLT
Download sequence
Identical sequences A0A2J8VI76 A0A2K5QJQ5 G3RCH7 K7BL36
NP_001193665.1.87134 NP_001193665.1.92137 XP_003953711.1.37143 XP_004061717.1.27298 XP_009231716.1.23681 XP_017371056.1.71028 gi|332078466|ref|NP_001193665.1| ENSP00000418529 ENSGGOP00000013207 ENSP00000371074 ENSGGOP00000013207 ENSP00000418529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]