SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418779 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418779
Domain Number 1 Region: 197-597
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.86e-107
Family GABA-aminotransferase-like 0.0000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418779   Gene: ENSG00000023330   Transcript: ENST00000484952
Sequence length 640
Comment pep:known chromosome:GRCh37:3:52232160:52248308:1 gene:ENSG00000023330 transcript:ENST00000484952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKE
TPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPATSQGTASKCPFLAAQMNQRGS
SVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPE
RVSHLLQDNLPKSVSTFQYDRFFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLI
TKKQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHGAGAGGTRNISGTSKFHVDLERELADL
HGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHND
VSHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYG
ARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSSLIDTVRSYAAGFIFTTSLPPM
LLAGALESVRILKSAEGRVLRRQHQRNVKLMRQMLMDAGLPVVHCPSHIIPVRVADAAKN
TEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLE
LKPHSSAECNFCRRPLHFEVMSEREKSYFSGLSKLVSAQA
Download sequence
Identical sequences H2QMR0 P13196 Q5JAM2
ENSP00000309259 ENSP00000309259 ENSP00000378416 ENSP00000417719 ENSP00000418779 ENSP00000309259 ENSP00000378416 ENSP00000417719 ENSP00000418779 NP_000679.1.87134 NP_000679.1.92137 NP_001291372.1.87134 NP_001291372.1.92137 NP_954635.1.87134 NP_954635.1.92137 XP_003818815.1.60992 XP_008970392.1.60992 XP_009443860.1.37143 XP_016796712.1.37143 XP_516501.2.37143 9598.ENSPTRP00000025879 9606.ENSP00000309259 ENSPTRP00000025879 gi|40316939|ref|NP_954635.1| gi|4502025|ref|NP_000679.1| ENSPTRP00000025879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]