SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419134 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419134
Domain Number 1 Region: 62-149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000582
Family G proteins 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419134   Gene: ENSG00000171109   Transcript: ENST00000467174
Sequence length 154
Comment pep:known chromosome:GRCh37:3:179065838:179080198:1 gene:ENSG00000171109 transcript:ENST00000467174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGY
KDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDG
DKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKA
Download sequence
Identical sequences C9JXQ1
ENSP00000419134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]