SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419502 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419502
Domain Number 1 Region: 157-283
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000647
Family 28-residue LRR 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419502   Gene: ENSG00000181350   Transcript: ENST00000470794
Sequence length 344
Comment pep:known chromosome:GRCh37:17:16346575:16395332:-1 gene:ENSG00000181350 transcript:ENST00000470794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGAGMPPYHRRVGMVQE
LLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYI
HCPKPEGDALGAMEKLCRQLTYHLSPHSQWRRHRGLVKRKPQACLKAVLAGSPPDNTVDL
SGIPLTSRDLERVTSYLQRCGEQVDSVELGFTGLTDDMVLQLLPALSTLPRLTTLALNGN
RLTRAVLRDLTDILKDPSKFPNVTWIDLGNNVDIFSLPQPFLLSLRKRSPKQGHLPTILE
LGEGPGSGEEVREGTVGQEDPGGGPVAPAEDHHEGKETVAAAQT
Download sequence
Identical sequences Q8NAA5
ENSP00000419502 ENSP00000419502 ENSP00000419502 ENSGGOP00000004977 ENSGGOP00000022198 NP_001107039.1.87134 NP_001107039.1.92137 gi|165932385|ref|NP_001107039.1| 9606.ENSP00000419502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]