SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420288 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420288
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000211
Family Protein kinases, catalytic subunit 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420288   Gene: ENSG00000133597   Transcript: ENST00000473512
Sequence length 223
Comment pep:novel chromosome:GRCh37:7:140378955:140394881:1 gene:ENSG00000133597 transcript:ENST00000473512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDLRYEAQNLEHFQVNFRNVKAVKFPTPLRPFVTREVLVETYEESVPVSSYQQAGIPVDL
KRKIARLGINMLLKMIFVDNFVHADLHPGNILVQGANGLSSSQEAQLQQADICDTLVVAV
PSSLCPLRLVLLDAGIVAELQAPDLRNFRAVFMAVVMGQLHVSSLLSSVFKLLMTHKVKL
ESNFASIVFAIMVLEGLGRSLDPKLDILEAARPFLLTGPVCPP
Download sequence
Identical sequences H7C5M5
ENSP00000420288 ENSP00000420288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]