SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420344 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420344
Domain Number 1 Region: 53-129
Classification Level Classification E-value
Superfamily UBA-like 5.11e-20
Family UBA domain 0.0001
Further Details:      
 
Domain Number 2 Region: 8-51
Classification Level Classification E-value
Superfamily UBA-like 0.00000000104
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420344   Gene: ENSG00000013374   Transcript: ENST00000460712
Sequence length 202
Comment pep:putative chromosome:GRCh37:7:151065819:151074367:1 gene:ENSG00000013374 transcript:ENST00000460712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREILLSNPQM
WWLNDSNPETDNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSL
PPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLED
EEIIIAEYLSYVENRKSATKKN
Download sequence
Identical sequences H7C5N1
ENSP00000420344 ENSP00000420344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]