SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420696 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420696
Domain Number 1 Region: 70-133,192-292
Classification Level Classification E-value
Superfamily HAD-like 1.84e-33
Family Meta-cation ATPase, catalytic domain P 0.083
Further Details:      
 
Domain Number 2 Region: 104-116,293-328
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000196
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 
Weak hits

Sequence:  ENSP00000420696
Domain Number - Region: 12-87
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00048
Family Metal cation-transporting ATPase, ATP-binding domain N 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420696   Gene: ENSG00000068650   Transcript: ENST00000471555
Sequence length 352
Comment pep:known chromosome:GRCh37:13:113496623:113540427:1 gene:ENSG00000068650 transcript:ENST00000471555 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDRE
KKLAEAYEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCY
ACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLI
IDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPI
TLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRI
SELVQYFFYKNVCFIFPQFLYQFFCGFSQQGRRQECPAALARVHLLDAPGTV
Download sequence
Identical sequences H0Y8F0
ENSP00000420696 ENSP00000420696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]