SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420752 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420752
Domain Number 1 Region: 10-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420752   Gene: ENSG00000176542   Transcript: ENST00000491165
Sequence length 88
Comment pep:putative chromosome:GRCh37:3:113367232:113415493:-1 gene:ENSG00000176542 transcript:ENST00000491165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEMTENETPTKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILD
QAFKYITELKRQNDELLLNGGNNEQGFY
Download sequence
Identical sequences A0A1D5QKU4 A0A2I2ZNB0 A0A2I3MID3 A0A2I3SUH9 A0A2J8W2K2 A0A2K5JJ61 A0A2K5NSI4 A0A2K5SAQ9 A0A2K5V2C7 A0A2K6CPD9 A0A2K6N223 A0A2K6NXF2 A0A2K6TDE4 C9JBW0
ENSP00000420752 ENSP00000420752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]