SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421203 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421203
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily UBC-like 3.39e-28
Family UBC-related 0.00000608
Further Details:      
 
Domain Number 2 Region: 106-147
Classification Level Classification E-value
Superfamily UBA-like 7.79e-23
Family UBA domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421203   Gene: ENSG00000078140   Transcript: ENST00000503368
Sequence length 149
Comment pep:known chromosome:GRCh37:4:39699783:39780330:1 gene:ENSG00000078140 transcript:ENST00000503368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVLKSEEVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLL
SLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCA
MGFDRNAVIVALSSKSWDVETATELLLSN
Download sequence
Identical sequences A0A0J9YU07 A0A1S2ZZJ6 A0A1S3EKN6 A0A286Y0B6 A0A286ZXT8 A0A287D853 A0A2I2YI59 A0A2I3N5T1 A0A2J8TCU2 A0A2K5CAA6 A0A2K5JDP1 A0A2K5M3J4 A0A2K5R3Y1 A0A2K5UQW7 A0A2K5Y3W8 A0A2K6FJ09 A0A2K6LM81 A0A2K6PAE1 A0A2K6UUQ9 F6U8R5 K7DDA3
NP_001104583.1.87134 NP_001104583.1.92137 NP_001297547.1.92730 XP_004384720.1.4749 XP_004579203.1.84141 XP_004642702.1.9945 XP_004703217.1.18182 XP_005149180.1.78019 XP_005243256.1.75256 XP_005902054.1.15283 XP_005956608.1.78601 XP_006732382.1.47382 XP_006873284.1.41390 XP_006895462.1.29581 XP_006922508.1.64745 XP_007447991.1.90284 XP_007496607.1.35504 XP_007527048.1.11023 XP_007945333.1.48129 XP_008138456.1.99482 XP_009445761.1.37143 XP_011361051.1.92234 XP_011804478.1.43180 XP_011838957.1.47321 XP_011989067.1.54773 XP_012667416.1.62490 XP_012864505.1.60039 XP_015975440.1.101085 XP_016836028.1.69978 XP_019818172.1.53367 XP_021066163.1.100879 XP_851187.2.84170 ENSMMUP00000014860 ENSP00000421203 ENSP00000421203 gi|163660387|ref|NP_001104583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]