SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421217 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421217
Domain Number 1 Region: 4-59
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000000214
Family GABA-aminotransferase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421217   Gene: ENSG00000164089   Transcript: ENST00000512320
Sequence length 60
Comment pep:putative chromosome:GRCh37:4:109677585:109683691:-1 gene:ENSG00000164089 transcript:ENST00000512320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVI
Download sequence
Identical sequences A0A2J8M2G1 D6RGG2
ENSP00000421217 ENSP00000421217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]