SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421389 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421389
Domain Number 1 Region: 10-209
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.53e-28
Family AAT-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421389   Gene: ENSG00000109576   Transcript: ENST00000507375
Sequence length 209
Comment pep:known chromosome:GRCh37:4:170994312:171011447:-1 gene:ENSG00000109576 transcript:ENST00000507375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLT
Download sequence
Identical sequences D6RFY7
ENSP00000421389 ENSP00000421389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]