SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421621 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421621
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily NTF2-like 7.89e-24
Family NTF2-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421621   Gene: ENSG00000138757   Transcript: ENST00000511868
Sequence length 99
Comment pep:known chromosome:GRCh37:4:76582793:76649709:-1 gene:ENSG00000138757 transcript:ENST00000511868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQND
IHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLS
Download sequence
Identical sequences A0A2J8PFN1 A0A2J8UU38 D6REX8
ENSP00000421621 ENSP00000421621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]