SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421780 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421780
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily UBC-like 0.0000000000000165
Family UBC-related 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421780   Gene: ENSG00000013561   Transcript: ENST00000513019
Sequence length 99
Comment pep:known chromosome:GRCh37:5:141346385:141354512:1 gene:ENSG00000013561 transcript:ENST00000513019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQN
SGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLS
Download sequence
Identical sequences A0A2J8NIV8 A0A2J8VP01 D6RAS4
ENSP00000421780 ENSP00000421780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]