SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422001 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422001
Domain Number 1 Region: 20-61
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000567
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422001   Gene: ENSG00000109323   Transcript: ENST00000511813
Sequence length 68
Comment pep:known chromosome:GRCh37:4:103645031:103682140:-1 gene:ENSG00000109323 transcript:ENST00000511813 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRLHLLLLLALCGAGTTAAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQS
LTLSPRLE
Download sequence
Identical sequences A0A2J8MAY7 D6RA01
ENSP00000422001 ENSP00000422001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]