SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422235 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000422235
Domain Number - Region: 7-55
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0736
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422235   Gene: ENSG00000090316   Transcript: ENST00000512308
Sequence length 67
Comment pep:known chromosome:GRCh37:4:1283679:1321491:1 gene:ENSG00000090316 transcript:ENST00000512308 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAVQESAAQLSMTLKVQEYPTLKNIPAWKPRCARPLHWPQKPHLSAEEPGCCLEWVSSTA
WQHSHAS
Download sequence
Identical sequences D6R8Z3
ENSP00000422235 ENSP00000422235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]