SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422436 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000422436
Domain Number - Region: 45-76
Classification Level Classification E-value
Superfamily UBA-like 0.00332
Family CUE domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422436   Gene: ENSG00000078177   Transcript: ENST00000511480
Sequence length 99
Comment pep:known chromosome:GRCh37:4:40058533:40159871:1 gene:ENSG00000078177 transcript:ENST00000511480 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MPRRRKNLGGNPFRKTANPKEVVVSSVASREEPTTTLPSMGETKVDQEELFTSISEIFSD
LDPDVVYLMLSECDFKGNLIGCLLGASSCAQHFFMDYLI
Download sequence
Identical sequences A0A2J8PGS7 A0A2J8TCU6 D6RC09
ENSP00000422436 ENSP00000422436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]