SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422877 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422877
Domain Number 1 Region: 14-227
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.68e-53
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 234-275
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000115
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422877   Gene: ENSG00000164122   Transcript: ENST00000512254
Sequence length 276
Comment pep:putative chromosome:GRCh37:4:177136724:177162827:-1 gene:ENSG00000164122 transcript:ENST00000512254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLCNGGNLAVTGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLG
DHVACARTLLEAGANVNAITIDGVTPLFNACSQGSPSCAELLLEYGAKAQLESCLPSPTH
EAASKGHHECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGADVQKGKYW
DTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSL
YQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQYR
Download sequence
Identical sequences A0A2I3SMY3
XP_008975333.1.60992 XP_011529919.1.92137 ENSP00000422877 ENSP00000422877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]