SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423188 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423188
Domain Number 1 Region: 89-143
Classification Level Classification E-value
Superfamily F-box domain 1.31e-16
Family F-box domain 0.0001
Further Details:      
 
Domain Number 2 Region: 138-149,176-249
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000216
Family Cyclin A/CDK2-associated p19, Skp2 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423188   Gene: ENSG00000145604   Transcript: ENST00000513151
Sequence length 255
Comment pep:novel chromosome:GRCh37:5:36152230:36171835:1 gene:ENSG00000145604 transcript:ENST00000513151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFST
LAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETI
TQLNLSGYRKNLQKS
Download sequence
Identical sequences A0A2J8JS99 D6R9R7
ENSP00000423188 ENSP00000423188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]