SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423572 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423572
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-22
Family Canonical RBD 0.0029
Further Details:      
 
Domain Number 2 Region: 74-140
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-20
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423572   Gene: ENSG00000173933   Transcript: ENST00000506523
Sequence length 150
Comment pep:putative chromosome:GRCh37:11:66406189:66417401:1 gene:ENSG00000173933 transcript:ENST00000506523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQDIQLCHPSCSVVA
Download sequence
Identical sequences A0A2J8QB86 D6R9K7
ENSP00000423572 XP_008952380.1.60992 ENSP00000423572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]