SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423815 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423815
Domain Number 1 Region: 25-185
Classification Level Classification E-value
Superfamily EF-hand 2.97e-44
Family Penta-EF-hand proteins 0.000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423815   Gene: ENSG00000249915   Transcript: ENST00000507528
Sequence length 189
Comment pep:novel chromosome:GRCh37:5:271772:315084:1 gene:ENSG00000249915 transcript:ENST00000507528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS
GYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQ
YLSMVFSIV
Download sequence
Identical sequences H9FNC2
ENSP00000423815 NP_001254485.1.87134 NP_001254485.1.92137 XP_005556576.1.63531 XP_017723844.1.44346 XP_018868810.1.27298 ENSP00000423815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]