SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424632 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424632
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.56e-19
Family Hexokinase 0.00028
Further Details:      
 
Domain Number 2 Region: 70-131
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.05e-19
Family Hexokinase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424632   Gene: ENSG00000160883   Transcript: ENST00000514058
Sequence length 131
Comment pep:novel chromosome:GRCh37:5:176308957:176311135:-1 gene:ENSG00000160883 transcript:ENST00000514058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GILLNWTKGFKASDCEGQDVVSLLREAITRRQAVELNVVAIVNDTVGTMMSCGYEDPRCE
IGLIVASTLSGLSAGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGDDGSLAMLSTR
FDASVDQASIN
Download sequence
Identical sequences H0Y9N6
ENSP00000424632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]