SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424896 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424896
Domain Number 1 Region: 185-540
Classification Level Classification E-value
Superfamily DNase I-like 2.75e-37
Family Sphingomyelin phosphodiesterase-like 0.028
Further Details:      
 
Domain Number 2 Region: 47-151
Classification Level Classification E-value
Superfamily L domain-like 2.31e-22
Family Ngr ectodomain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424896   Gene: ENSG00000138767   Transcript: ENST00000504123
Sequence length 555
Comment pep:known chromosome:GRCh37:4:78634541:78740522:-1 gene:ENSG00000138767 transcript:ENST00000504123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTA
LHLNDNYLSRIPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNLLRVLPYE
LGRLFQLQTLGLKGNPLSQDILNLYQDPDGTRKLLNFMLDNLAVHPEQLPPRPWITLKER
DQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNCDADIISLQE
VETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAH
MHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVV
EYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNY
TFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELHP
PLLPLVNGVHLPNRR
Download sequence
Identical sequences A0A096MQN8 A0A0D9QX23 A0A2I3FRJ8 A0A2I3S8J0 A0A2J8UUD8 A0A2K5CTE8 A0A2K5I1C9 A0A2K5LCS7 A0A2K5QEU2 A0A2K5VLN0 A0A2K6DK01 A0A2K6EYX3 H9YUJ6 Q96LI5 W5Q8M8
ENSNLEP00000009984 gi|115583679|ref|NP_653172.2| ENSP00000424896 ENSPANP00000007736 ENSPTRP00000027832 ENSP00000264903 ENSP00000424896 9606.ENSP00000264903 ENSOARP00000019070 ENSNLEP00000009984 NP_001178452.1.59421 NP_001178452.1.76553 NP_001248222.1.72884 NP_001273719.1.87134 NP_001273719.1.92137 NP_653172.2.87134 NP_653172.2.92137 XP_003265839.1.23891 XP_003265840.1.23891 XP_003310375.1.37143 XP_003364735.1.31192 XP_004009981.1.66739 XP_004280220.1.21590 XP_004383175.1.4749 XP_005555035.1.63531 XP_005555036.1.63531 XP_005681862.1.57651 XP_005890260.1.15283 XP_005965678.1.78601 XP_006151533.2.99106 XP_007165643.1.59432 XP_007165644.1.59432 XP_007455472.1.90284 XP_007997173.1.81039 XP_011731948.1.29376 XP_011731950.1.29376 XP_011782626.1.43180 XP_011895743.1.92194 XP_011978228.1.54773 XP_012035621.1.66739 XP_012302389.1.9421 XP_014993931.1.72884 XP_017395520.1.71028 XP_019788327.1.83887 XP_019818544.1.53367 XP_019818545.1.53367 XP_523084.3.37143 ENSPTRP00000027832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]