SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425029 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425029
Domain Number 1 Region: 58-123
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000353
Family HLH, helix-loop-helix DNA-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425029   Gene: ENSG00000213347   Transcript: ENST00000502529
Sequence length 124
Comment pep:novel chromosome:GRCh37:5:176734883:176738897:-1 gene:ENSG00000213347 transcript:ENST00000502529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRR
AQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLKERLRSKQQSL
QRQL
Download sequence
Identical sequences D6RED4
ENSP00000425029 ENSP00000425029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]