SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425085 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425085
Domain Number 1 Region: 68-117
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000288
Family Hairy Orange domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSP00000425085
Domain Number - Region: 38-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00301
Family HLH, helix-loop-helix DNA-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425085   Gene: ENSG00000188290   Transcript: ENST00000484667
Sequence length 189
Comment pep:novel chromosome:GRCh37:1:934350:935361:-1 gene:ENSG00000188290 transcript:ENST00000484667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSRHSKLEKADILEMTVRHLRSLR
RVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGP
SRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGP
GGPWRPWLR
Download sequence
Identical sequences D6REB3
XP_005244828.1.92137 ENSP00000425085 ENSP00000425085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]