SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425184 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425184
Domain Number 1 Region: 120-435
Classification Level Classification E-value
Superfamily RNI-like 5.76e-47
Family Cyclin A/CDK2-associated p19, Skp2 0.0062
Further Details:      
 
Domain Number 2 Region: 60-110
Classification Level Classification E-value
Superfamily F-box domain 2.22e-17
Family F-box domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425184   Gene: ENSG00000183580   Transcript: ENST00000510662
Sequence length 444
Comment pep:putative chromosome:GRCh37:5:15501547:15937328:1 gene:ENSG00000183580 transcript:ENST00000510662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLSTPSPALICPPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRP
QKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVD
RALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISN
EAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLED
EGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAK
LESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSL
DIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVS
VEALRFVKRHCKRCVIEHTNPAFF
Download sequence
Identical sequences A0A096MSM9 A0A2J8L4L9 A0A2K6NJ82 G7MUP2 G7P793
NP_001265246.1.87134 NP_001265246.1.92137 XP_010372395.1.97406 XP_011512300.1.92137 XP_011849574.1.47321 XP_011915837.1.92194 XP_011915838.1.92194 XP_016808462.1.37143 XP_017711437.1.44346 ENSP00000425184 ENSP00000425184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]