SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425301 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425301
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily UBC-like 2.68e-20
Family UBC-related 0.0000205
Further Details:      
 
Domain Number 2 Region: 96-123
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000042
Family UBA domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425301   Gene: ENSG00000078140   Transcript: ENST00000510934
Sequence length 123
Comment pep:novel chromosome:GRCh37:4:39699729:39780004:1 gene:ENSG00000078140 transcript:ENST00000510934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIV
ALS
Download sequence
Identical sequences A0A2J8PGU2 A0A2J8TCU0 D6RDM7
ENSP00000425301 ENSP00000425301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]