SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425472 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425472
Domain Number 1 Region: 247-346,505-601
Classification Level Classification E-value
Superfamily RNI-like 1.6e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 
Domain Number 2 Region: 125-211
Classification Level Classification E-value
Superfamily F-box domain 2.09e-18
Family F-box domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSP00000425472
Domain Number - Region: 451-494
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.1
Family Blood coagulation inhibitor (disintegrin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425472   Gene: ENSG00000118564   Transcript: ENST00000513163
Sequence length 612
Comment pep:novel chromosome:GRCh37:4:15606629:15646272:-1 gene:ENSG00000118564 transcript:ENST00000513163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKVFQPMLM
EYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNHAEERQKFFKYSVDEKSDKEAEVS
EHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSMKWSQLTKTGSLWKHLYPVHWARGDWY
SGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEESAEESIAISIAQMEKRLLHG
LIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWL
GCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLKTSTSKITSTAWKNKDITMQ
STKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVWMLDAEDLADIEDTVEWRHR
NVESLCVMETASNFSCSTSGCFSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRT
MSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVL
TLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNL
QCGFRACCRSGE
Download sequence
Identical sequences H0Y9Y0
ENSP00000425472 ENSP00000425472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]