SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425571 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425571
Domain Number 1 Region: 192-547
Classification Level Classification E-value
Superfamily DNase I-like 2.88e-37
Family Sphingomyelin phosphodiesterase-like 0.028
Further Details:      
 
Domain Number 2 Region: 54-158
Classification Level Classification E-value
Superfamily L domain-like 3.67e-24
Family Ngr ectodomain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425571   Gene: ENSG00000138767   Transcript: ENST00000512485
Sequence length 562
Comment pep:putative chromosome:GRCh37:4:78641384:78740769:-1 gene:ENSG00000138767 transcript:ENST00000512485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPRRAECRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLW
SLTHLTALHLNDNYLSRIPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNL
LRVLPYELGRLFQLQTLGLKGNPLSQDILNLYQDPDGTRKLLNFMLDNLAVHPEQLPPRP
WITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNCDA
DIISLQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFT
LVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQL
LIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNS
LPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENN
LMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLL
TQLELHPPLLPLVNGVHLPNRR
Download sequence
Identical sequences A0A2I3MLI1 A0A2J8UUD1 A0A2K5CTC8 A0A2K5LCS2 A0A2K5QES0 A0A2K6DJZ0 A0A2K6EYX6 G3QM82 H0Y9Z5 H2QPR6
ENSP00000425571 ENSP00000424896 ENSP00000425571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]