SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425649 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000425649
Domain Number - Region: 3-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00209
Family SCF ubiquitin ligase complex WHB domain 0.084
Further Details:      
 
Domain Number - Region: 141-179
Classification Level Classification E-value
Superfamily UBA-like 0.0505
Family TAP-C domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425649   Gene: ENSG00000112659   Transcript: ENST00000506830
Sequence length 195
Comment pep:known chromosome:GRCh37:6:43181561:43192323:1 gene:ENSG00000112659 transcript:ENST00000506830 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
QKRNLLSCLLVRILKAHGEKGLHIDQLVCLVLEAWQKGPNPPGTLGHTVAGGVACTSTDV
LSCILHLLGQGYVKRRDDRPQILMYAAPEPMGPCRGQADVPFCGSQSETSKPSPEAVATL
ASLQLPAGRTMSPQEVEGLMKQTVRQVQETLNLEPDVAQHLLAHSHWGAEQLLQSYSEDP
EPLLLAAGLLAGMST
Download sequence
Identical sequences A0A2J8P053 H0YA00
ENSP00000425649 ENSP00000425649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]