SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426033 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426033
Domain Number 1 Region: 10-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 82-125
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000235
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426033   Gene: ENSG00000187821   Transcript: ENST00000515777
Sequence length 242
Comment pep:novel chromosome:GRCh37:4:185939995:185941950:1 gene:ENSG00000187821 transcript:ENST00000515777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQ
YLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILA
FLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPP
GAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPP
VL
Download sequence
Identical sequences A0A2J8L870 A6NFD8
ENSPTRP00000028543 ENSPTRP00000028543 ENSP00000426033 NP_001287710.1.87134 NP_001287710.1.92137 ENSP00000426033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]