SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426163 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426163
Domain Number 1 Region: 31-321
Classification Level Classification E-value
Superfamily RNI-like 1.73e-44
Family Cyclin A/CDK2-associated p19, Skp2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426163   Gene: ENSG00000153558   Transcript: ENST00000507198
Sequence length 355
Comment pep:novel chromosome:GRCh37:3:33318968:33427254:1 gene:ENSG00000153558 transcript:ENST00000507198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNF
QTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDS
TCYSLSRFCSKLKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLT
DASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLS
IHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLENCRGL
ERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCCVIL
Download sequence
Identical sequences A0A1D5QH46 A0A2I3GQE0 A0A2I3M031 A0A2I3RB49 A0A2J8WYQ3 A0A2K6R3Q2
ENSP00000426163 ENSP00000441228 NP_001165184.1.87134 NP_001165184.1.92137 XP_003256881.1.23891 XP_010371269.1.97406 ENSP00000426163 ENSP00000441228 gi|284447314|ref|NP_001165184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]