SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426269 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426269
Domain Number 1 Region: 46-146
Classification Level Classification E-value
Superfamily L domain-like 5.78e-24
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426269   Gene: ENSG00000138767   Transcript: ENST00000515441
Sequence length 163
Comment pep:putative chromosome:GRCh37:4:78678016:78740544:-1 gene:ENSG00000138767 transcript:ENST00000515441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTA
LHLNDNYLSRIPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNLLRVLPYE
LGRLFQLQTLGLKGNPLSQDILNLYQDPDGTRKLLNFMLDNLA
Download sequence
Identical sequences A0A2J8PFW8 A0A2J8UUD5 D6RGK9
ENSP00000426269 ENSP00000426269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]